PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG732400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 541aa    MW: 57718.4 Da    PI: 5.9312
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG732400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS339.65.3e-1041665391374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvsel....ykalppsetseknsseelaalklfse 86 
                          lv+lL++cAeav+ +d ++a alL +l+  a  +g+++qR+a++f+++La rla   +      + a+   ++ + +   +  al l +e
  Pavir.5KG732400.1.p 166 LVQLLVACAEAVACRDRAQAAALLRELQVGAPVHGTAFQRVASCFVQGLADRLALAHPPAlgpaSMAFCIPPSCTGRDGARGEALALAYE 255
                          689**************************************************9865544111122333333333346777788899*** PP

                 GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAee 171
                          ++P+l+f+h++aN  Ilea+ege+ vH++D++++     G QW  Ll+ La+R++ +p ++ iTgvg+     +++++ +g+ L+ +Ae 
  Pavir.5KG732400.1.p 256 LCPYLRFAHFVANASILEAFEGESNVHVVDLGMTlgldRGHQWRGLLDGLAARAGAKPkRVCITGVGA----AADTMRVVGRELEAYAEG 341
                          ******************************98762222567*************66665*********....99**************** PP

                 GRAS 172 lgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                          lg+ +ef++ v ++le+l++++L ++ +Ea+a+n++l+lh +++es    +   +vL+++++lsPk +v+veq+a hn++ Fl rf+eal
  Pavir.5KG732400.1.p 342 LGMYLEFRA-VDRSLESLHIDDLGIDADEAVAINSILELHCVVKESRGALN---SVLQTIRKLSPKAFVLVEQDAGHNGPFFLGRFMEAL 427
                          *********.799******************************88877777...8*********************************** PP

                 GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyr 350
                          +yy+a+fd+l+a lpr +  r+ vE++ +g ei+nvv cega+r+erhe++ +Wr+r+++aGF++vp++    + a+  l + + + gy+
  Pavir.5KG732400.1.p 428 HYYAAVFDALDAALPRYDARRARVEQFHFGAEIRNVVGCEGAARVERHERADQWRRRMSRAGFQSVPIRMA--ARAREWLDENAgGGGYT 515
                          ********************************************************************865..467777777776999** PP

                 GRAS 351 veeesgslvlgWkdrpLvsvSaWr 374
                          v ee+g+lvlgWk++p++++S+W+
  Pavir.5KG732400.1.p 516 VAEEKGCLVLGWKGKPIIAASCWK 539
                          ***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.239140520IPR005202Transcription factor GRAS
PfamPF035141.8E-101166539IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MGMSEQPCRS PPSSFTTSYG SSQQIIHPLP QHDAVLCTEP GLGFPYYYGT DQQDAAFDGD  60
EVELGFRASK VTKVDYYSSP YQPSWPLACA DVAAAAAESS RVRKQRFRDV LETCKQKVEA  120
IEAMESPVAF QEGEDGGIAG DGAGATGGGG SGGGGSGSGG ADGMRLVQLL VACAEAVACR  180
DRAQAAALLR ELQVGAPVHG TAFQRVASCF VQGLADRLAL AHPPALGPAS MAFCIPPSCT  240
GRDGARGEAL ALAYELCPYL RFAHFVANAS ILEAFEGESN VHVVDLGMTL GLDRGHQWRG  300
LLDGLAARAG AKPKRVCITG VGAAADTMRV VGRELEAYAE GLGMYLEFRA VDRSLESLHI  360
DDLGIDADEA VAINSILELH CVVKESRGAL NSVLQTIRKL SPKAFVLVEQ DAGHNGPFFL  420
GRFMEALHYY AAVFDALDAA LPRYDARRAR VEQFHFGAEI RNVVGCEGAA RVERHERADQ  480
WRRRMSRAGF QSVPIRMAAR AREWLDENAG GGGYTVAEEK GCLVLGWKGK PIIAASCWKC  540
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-521665394375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037910.0AP003791.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1065G12.
GenBankAP0067570.0AP006757.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0551C06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970957.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLK3XGD90.0K3XGD9_SETIT; Uncharacterized protein
STRINGSi000959m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56403354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.17e-63RGA-like 1